Self Assembling nanites part one.

Top down: grind down a material into its wanted shape but creates waste. 

Bottom up: build slowly the intricate parts. 

A solid method is to create the nanites in a combined fashion. 

You’re building cubli’s. 

Use: pyrolysis carbon casing to be safe incase of failure inside the body and allow available attachments to drugs or operating tools. Cancerous bone is weak. (I believe so you may not need carbide tips to get through if going slowly enough). Sewing systems can join molecularly within the body at attachment points similar to spider web sacks joining together in series and rotated out with a twist to the nearest neighbor to continue the feed until the suture is done. 

Top down to manufacture housing and empty inside shell. A series of holes is drilled at each cross corner so as to not be totally flat, where you’ll later bond conductive material to electro magnetize those sides and corners using dip pen lithography.  

Waste is removed continuously and recycled into pure material once atomic slag is removed if any. 

Bottom-up using recycled innards plus additional materials to build control mechanics. 

Molecular beam epitaxy to lay films of atoms inside the inner workings in specific orders or “shells” until all moving and inert parts are manufactured and in place as warranted. Will have to ask the creators or a computer optimization algorithm to find the best method. Battery cells will have to be dropped into place and connected with dip pen lithography again. 

Build the system on a roll to roll “conveyer system” and you end up with the finished product at the end. 

Test outside body on cancerous white blood cells with users artificial cytokines and antibodies. Or coronaviruses.  Force them to encircle the viruses as artificial kill cells and use the batteries to heat the systems conductive materials with partial RBCs cellular make up on the drug attachment points that the corona wants to bond to and then heat to the viruses destruction point and the virus is eradicated from within with simple nanites. Remove dirty nanites from system. Clean. Repeat. 

Using cubli’s To deliver drugs against or with blood flow at any size including to fight bone marrow and lymphoma cancers. The first en mass medical nanites.

Here’s the basic design of them. I don’t know why this wasn’t done straight away.

Here’s the basic design. Three rotating sides against an inner torque mechanism to get it to jump. Or balance on one side. Or move in a controlled fall. If you place those inside an exterior set of shells including a medication you can do a myriad of healing things with them, while also controlling a series of them in succession or at once to sew from the inside out, deliver medicines as far as into the bone inside an implant that may or may not need to be removed later to treat bone cancer. Treat lymphomas by surrounding the white blood cells at their choke points or found areas of travel. Much less painful than chemo as you could irradiate the bot, have them hit their points of impact and then head to a port and attach, magnetically, through cancerous tissue collection, like collecting in a net—while flushing the user with fresh healthy white blood cells from their own stem cells so they don’t become continuously cancerous. 

These could easily be the first series of nanites used to treat all sorts of sicknesses. 

Hope you have a wonderful day/night.
-J.

Blue and red are poles of magnets also need corner attachments so that they can be “twisted or twisting” as they move within the body. Green would be the drugs/ tools to work within the body.

It’s about that simple. I can draw this up in solid works if you like.

There seems to be a Boson (negatively charged) missing from the roster.

IMG_0046.jpeg

Mass/Charge/Spin:

Use Helium-3 

Lithium Titanate -> (Lithium pebble breeders)

Tritium (Hydrogen3)-> Helium3 

This is a Boson (Hopefully not muon) build. 
Seems to be a negative Boson missing. 

Here’s an idea of what the build may be if that’s ever not found: 
You have your Z and W bosons, both with Mass and spin. You use the superfluidity of Helium3 to force the heavy bosons, like that of a bombarding Higgs Boson in succession through a series of Z alternating W bosons so that they collide and are forced into differing areas as the Higgs pushes against them “upwards” in the superfluid. 

As they collide they get excited and release energy towards the top of the system as heat which can be cycled off as electricity as well as radioactivity. Changing the near zero temp at the bottom to a higher range, forcing the cooler superfluid to compress below the heating superfluid before it sublimates into another form where it will take a change state and become some form of energy carrier. Hopefully by splitting (or combining the overall energy of) a Z and a W boson. 

Those that don’t release energy or bond to another atom, knowing that the boson is a force carrier and “holds” matter in place while a superfluid does the exact opposite—you should get an artificial friction between the two creating a new type of material be it magnetic flow type, Eddie currents, or attraction/repulsion between the two as the electrons are expanded and the pulling forces between the two become much greater. 

Once a negative spin Boson is found then it’s simplest to set up each of these parts as a battery as you would and bombard them with Higgs bosons as the electrolyte as they are the propulsion function within the superfluid, while the W boson would be your anode while you use the cathode boson to exit the energy out of the system in it’s multiple available forms. 

Turbulence: Improving Tokamak. Adding an additional layer of higher RF (mm) Wave or better at all points to create one smooth transition, or multi-collision eddies to increase neutron output. Drawings can be made if needed.

I have a field, controlled by magnets. A ring, within a ring. Causing a spiral of plasma to spin either counter clock wise or clock wise which can be changed upon build specifics. But they use RF to control the disruption of the material. So, we have Mag Field one, inner core, spinning around CCW, or CW, we have Mag Field two spinning within the system around it, to form a casing which spirals as it moves.  The spiral causes turbulence.

If it were a food it would be a doughnut. 
The plasma would be an eternal atomic pastry. The islands that cool the system down to uselessness would be the crust of the foodstuff reacting to the outer limits of the system, unbeknownst to the user. So what do you do to stale dough. You shear it away from the wanted plane as fast as possible before it ruins the rest of the dough.

So what’s to be done with our reactive doughnut? Let it continue on with it’s crust that forces a problem, or to sharpen a series of knives against the target in all points of contention possible and have them run as a continuous subsystem through their RF control modulations to become the disruption of disruption’s disruptor.

1GHZ+-20MG use of microwaves, means it must be of higher depth into the system to hit all points so that no islands may form. Means higher hertz minute width singularly but encompassing the entirety of the system so no islands may form this can be explained down below. 

If using hydrogen to react like the common copper connection ie freely moving electrons, you will get electron slag, where they have bounded off of one another or burnt out completely due to the age of the atom or the space available not being ideal within the plasma to cause some cooling effect. If the chain reaction lasts long enough you get these islands.  

Down below:

If you were to use mm RF Waves (I think I’m heading in the right direction, but if they’re not the smaller particles with a higher hertz move the other way please). 

you could hit all points of the plasma at once or in alternating waves at an angle to cause the internal spiral to lessen, become stagnant, or even reverse in eddies so as to have sectional heat relative to what is wanted but in a much smaller package as it has greater volume of collision points within the toroidal rings over time and the collection points can then be managed as needed down the very electron required as well. Then the neutrons spilling out wouldn’t be just one justified place, which is just a start, but many spoked areas. It also means if an island forms it is likely to form away from the points of collision or perhaps at the points of collision and we would have more information to work with. If it’s at the points of no collision, they’re too far apart and moving too slowly and that’s where you pump your energy back into the system. If it’s at the points of collision, it’s either a fusion or slag that has now been broken up into many smaller slivers that can be blasted through atomically or by a higher RF as stated above and broken down to its plasma heat level that everyone wants. Either way it might help with the design.  

A basic neural net from last night to fight SARS-COvid-02.

I’m unsure whether the main nodes extraneous markers need to be interconnected just for potential analyzation. The darker blue on the right side is the additional effects to be measured per layer one spoke. One spoke is location to next date marker so must continue in it’s own path on the left through the system. Connecting to location in layer three.
Layer two goes in both directions as the disease travel forms can change over time and on a whim.
Layer three is the splintering and conditional symptomatic change effect nodes.
The last node (blue) feeds into the next data set.


Artificial Atoms: As they relate to Quibits.

So far they’re using a single electron artificial atoms in quantum wells to become quibits. 

From what I’ve found in my lazy search they seem to think that quitrits and quadtrits are the maximum number of artificial trits that can be made since 2013—but that is incomplete.

The standard deviation of an atom is a nucleus wrapped around with electrons who travel in patterns around the nucleus in a wave/formed pattern. 


Thought experiment to get to the next point:

If you let a single atom float in a vacuum full of super fluid (assuming no possible bonds able) denying gravity’s hold on the density and mass of the atom, and the superfluid pushing against all parts of the atom at once dependent on the superfluids movement. Other than if we’re lucky enough to have stabilized superfluid after some time—inherent vibration withstanding. Would we be able to find the sole atoms exact electron travel within the confines. If so could we then release that atom in this fluid so that is it constantly “falling or rising” dependent on the superfluids movement around it. Depends on the containers shape. A single tube gives up. A s bend on it’s end middle gives down if from the proper side.  

So that we can then “open” an area where the electrons are centralized within a halo around the “top” or “bottom” of the sole atom. That would open up many stages to insert wavelengths  from within the containers walls or outside it if properly managed other than radio at once and change the planes that would be interacted to be actable more than singularly at once, so that you could actually hit one electron, infer it’s superimposed cousin from glimmering from the initial hit not the same as the other electrons and then the general direction of the superposition atoms direction outside the container. This may have to be done in a completely dark room. Dual vacuumed enclosure/dual superfluid to allow clarity. And if so would it be possible to set this example up twice, in either the same state or two opposing states so that you get that glimmer and can start to literally determine superpositions distance/locations.

At the same time we could do a different function where we hit multiple electrons at once causing them to pulse in ways we want—up, down, side to side, diagonal and since the electrons of the sole atoms are compressed between the superfluids electrons, if we time them, we could bounce from one atom to the other and back again, bending the super position—though technically not that—a new form of some kind (atomic J Hook?), around the same atom either the other side of the same electron or a cousin electron within the halo. From there we take all possible iterations of those atoms and wavelength iterations and we can build a table/dataset of superposition distances or at the least their angles. Knowing that by raising the superfluid temperature using light would possibly change it’s state we would have to start small with the lowest coolest lights possible. Or diffusion through a material to slow it down to it’s coolest speed though through a final lens to hit it’s target. Read speed isn’t important at first, it’s just the fact that we can figure out the change states in real time. 

Noticed SARS-COvid-02 has 19 dual Codon start paired triplets as well as 19 dual End Codon Paired triplets in it’s genome.

I’ve only been at this a few hours last night so forgive me if this is known information or unhelpful.

Scroll to the bottom of the page for the .pdf download of this. I need a geneticist to look it over to see if I’m going in any sort of right direction.

https://www.ncbi.nlm.nih.gov/nuccore/MT385497.1?expand-gaps=on
Work done by Jordan Townsend, 04/27/20

adenine, guanine, and cytosine, UraciL

CTACTA

ATAATA


adenine, guanine, and cytosine, thymine 

AUGAUG(19)UAAUAA(19)
GCAGCACGGCGG



AUGAUG and UAAUAA each have 19 iterations with 4 ends of UAGUAG and 25 UGAGUAG.

DNA bases that reflect these below at their ends:

GCAGCA = AlanineAlanine
CGGCGG = ArginineArginine

So could they be
atgatg ttcacatctg atttggctac taacaatcta gttgtaatgg

     2041 cctacattac aggtggtgtt gttcagttga cttcgcagtg gctaactaac atctttggca

     2101 ctgtttatga aaaactcaaa cccgtccttg attggcttga agagaagttt aaggaaggtg

     2161 tagagtttct tagagacggt tgggaaattg ttaaatttat ctcaacctgt gcttgtgaaa

     2221 ttgtcggtgg acaaattgtc acctgtgcaa aggaaattaa ggagagtgtt cagacattct

     2281 ttaagcttgt aaataaattt ttggctttgt gtgctgactc tatcattatt ggtggagcta

     2341 aacttaaagc cttgaattta ggtgaaacat ttgtcacgca ctcaaaggga ttgtacagaa

     2401 agtgtgttaa atccagagaa gaaactggcc tactcatgcc tctaaaagcc ccaaaagaaa

     2461 ttatcttctt agagggagaa acacttccca cagaagtgtt aacagaggaa gttgtcttga

     2521 aaactggtga tttacaacca ttagaacaac ctactagtga agctgttgaa gctccattgg

     2581 ttggtacacc agtttgtatt aacgggctta tgttgctcga aatcaaagac acagaaaagt

     2641 actgtgccct tgcacctaat atgatg

Screen Shot 2020-04-27 at 7.35.49 PM.png

VIRT-48375:5’3′ Frame 2, start_pos=37

MKNSNPSLIGLKRSLRKV

DNA: Input sequence

FLIMVSPTAYHQNKDECWRG

X*

Reverse Translated sequence

TTYYTNATHATGGTNWSNCCNACNGCNTAYCAYCARAAYAARGAYGARTGYTGGMGNGGN

NNNTRR

tgatgaccc gtgtcctatt cacttctatt ctaaatggta tattagagta

    28021 ggagctagaa aatcagcacc tttaattgaa ttgtgcgtgg atgaggctgg ttctaaatca

    28081 cccattcagt acatcgatat cggtaattat acagtttcct gttcaccttt tacaattaat

    28141 tgccaggaac ctaaattggg tagtcttgta gtgcgttgtt cgttctatga agacttttta

    28201 gagtatcatg acgttcgtgt tgttttagat ttcatctaaa cgaacaaact aaaatgtctg

    28261 ataatggacc ccaaaatcag cgaaatgcac cccgcattac gtttggtgga ccctcagatt

    28321 caactggcag taaccagaat ggagaacgca gtggggcgcg atcaaaacaa cgtcggcccc

    28381 aaggtttacc caataatact gcgtcttggt tcaccgctct cactcaacat ggcaaggaag

    28441 accttaaatt ccctcgagga caaggcgttc caattaacac caatagcagt ccagatgacc

    28501 aaattggcta ctaccgaaga gctaccagac gaattcgtgg tggtgacggt aaaatgaaag

    28561 atctcagtcc aagatggtat ttctactacc taggaactgg gccagaagct ggacttccct

    28621 atggtgctaa caaagacggc atcatatggg ttgcaactga gggagccttg aatacaccaa

    28681 aagatcacat tggcacccgc aatcctgcta acaatgctgc aatcgtgcta caacttcctc

    28741 aaggaacaac attgccaaaa ggcttctacg cagaagggag cagaggcggc agtcaagcct

    28801 cttctcgttc ctcatcacgt agtcgcaaca gttcaagaaa ttcaactcca ggcagcagta

    28861 ggggaacttc tcctgctaga atggctggca atggcggtga tgctgctctt gctttgctgc

    28921 tgcttgacag attgaaccag cttgagagca aaatgtctgg taaaggccaa caacaacaag

    28981 gccaaactgt cactaagaaa tctgctgctg aggcttctaa gaagcctcgg caaaaacgta

    29041 ctgccactaa agcatacaat gtaacacaag ctttcggcag acgtggtcca gaacaaaccc

    29101 aaggaaattt tggggaccag gaactaatca gacaaggaac tgattacaaa cattggccgc

    29161 aaattgcaca atttgccccc agcgcttcag cgttcttcgg aatgtcgcgc attggcatgg

    29221 aagtcacacc ttcgggaacg tggttgacct acacaggtgc catcaaattg gatgacaaag

    29281 atccaaattt caaagatcaa gtcattttgc tgaataagca tattgacgca tacaaaacat

    29341 tcccaccaac agagcctaaa aaggacaaaa agaagaaggc tgatga

Screen Shot 2020-04-27 at 7.37.28 PM.png

> VIRT-31882:5’3′ Frame 3, start_pos=29

MRLVLNHPFSTSISVIIQFPVHLLQLIARNLNWVVL

DNA:

Input sequence

FLIMVSPTAYHQNKDECWRG

X*

Reverse Translated sequence

TTYYTNATHATGGTNWSNCCNACNGCNTAYCAYCARAAYAARGAYGARTGYTGGMGNGGN

NNNTRR

I have no real idea if I’ve done anything helpful but if you find use from it or can point me in the direction of further study I would appreciate it. Thanks.
J.