Self Assembling nanites part one.

Top down: grind down a material into its wanted shape but creates waste. 

Bottom up: build slowly the intricate parts. 

A solid method is to create the nanites in a combined fashion. 

You’re building cubli’s. 

Use: pyrolysis carbon casing to be safe incase of failure inside the body and allow available attachments to drugs or operating tools. Cancerous bone is weak. (I believe so you may not need carbide tips to get through if going slowly enough). Sewing systems can join molecularly within the body at attachment points similar to spider web sacks joining together in series and rotated out with a twist to the nearest neighbor to continue the feed until the suture is done. 

Top down to manufacture housing and empty inside shell. A series of holes is drilled at each cross corner so as to not be totally flat, where you’ll later bond conductive material to electro magnetize those sides and corners using dip pen lithography.  

Waste is removed continuously and recycled into pure material once atomic slag is removed if any. 

Bottom-up using recycled innards plus additional materials to build control mechanics. 

Molecular beam epitaxy to lay films of atoms inside the inner workings in specific orders or “shells” until all moving and inert parts are manufactured and in place as warranted. Will have to ask the creators or a computer optimization algorithm to find the best method. Battery cells will have to be dropped into place and connected with dip pen lithography again. 

Build the system on a roll to roll “conveyer system” and you end up with the finished product at the end. 

Test outside body on cancerous white blood cells with users artificial cytokines and antibodies. Or coronaviruses.  Force them to encircle the viruses as artificial kill cells and use the batteries to heat the systems conductive materials with partial RBCs cellular make up on the drug attachment points that the corona wants to bond to and then heat to the viruses destruction point and the virus is eradicated from within with simple nanites. Remove dirty nanites from system. Clean. Repeat. 

Using cubli’s To deliver drugs against or with blood flow at any size including to fight bone marrow and lymphoma cancers. The first en mass medical nanites.

Here’s the basic design of them. I don’t know why this wasn’t done straight away.

Here’s the basic design. Three rotating sides against an inner torque mechanism to get it to jump. Or balance on one side. Or move in a controlled fall. If you place those inside an exterior set of shells including a medication you can do a myriad of healing things with them, while also controlling a series of them in succession or at once to sew from the inside out, deliver medicines as far as into the bone inside an implant that may or may not need to be removed later to treat bone cancer. Treat lymphomas by surrounding the white blood cells at their choke points or found areas of travel. Much less painful than chemo as you could irradiate the bot, have them hit their points of impact and then head to a port and attach, magnetically, through cancerous tissue collection, like collecting in a net—while flushing the user with fresh healthy white blood cells from their own stem cells so they don’t become continuously cancerous. 

These could easily be the first series of nanites used to treat all sorts of sicknesses. 

Hope you have a wonderful day/night.
-J.

Blue and red are poles of magnets also need corner attachments so that they can be “twisted or twisting” as they move within the body. Green would be the drugs/ tools to work within the body.

It’s about that simple. I can draw this up in solid works if you like.

Quantum Cooling beyond or at least closer to zero:

Take carbon tetrahedral diamonds who’s negative thermal coefficient means that it grows as it becomes colder means that you can add in heavier (or lighter) substances between the containing carbon and once it is locked into place will begin to cool as well until it forces a chain reaction and brings the carbon down to it’s least possible temperature.

Simple experiment: take an ice pop mold and fill it with one warmer material with a large negative coefficient. Fill the core with a second material with a larger negative coefficient, and both will swell until they are at their atomic limits but the center being stronger will force their still “warm” center to pull the cooling through the system cooling the carbon further, or at least the center atom(s), meaning you can get lower than near proper kelvin zero. 

Quantum Cooling beyond zero.jpeg

You don’t need the carbon to change form into a liquid when you can use a superfluid or a least atoms attempting to become a superfluid between the remaining spaces between the carbon atoms unable to escape that is weighed down by the carbon so that it either remains in a floating position or falls as wanted, or chained together or weighted with carbine which also expands due to the negative thermal coefficient and is attached to the bottom of the cooling canisters walls. They would need proper pressurization to insure that the canister didn’t pop along a seam. 

Noticed SARS-COvid-02 has 19 dual Codon start paired triplets as well as 19 dual End Codon Paired triplets in it’s genome.

I’ve only been at this a few hours last night so forgive me if this is known information or unhelpful.

Scroll to the bottom of the page for the .pdf download of this. I need a geneticist to look it over to see if I’m going in any sort of right direction.

https://www.ncbi.nlm.nih.gov/nuccore/MT385497.1?expand-gaps=on
Work done by Jordan Townsend, 04/27/20

adenine, guanine, and cytosine, UraciL

CTACTA

ATAATA


adenine, guanine, and cytosine, thymine 

AUGAUG(19)UAAUAA(19)
GCAGCACGGCGG



AUGAUG and UAAUAA each have 19 iterations with 4 ends of UAGUAG and 25 UGAGUAG.

DNA bases that reflect these below at their ends:

GCAGCA = AlanineAlanine
CGGCGG = ArginineArginine

So could they be
atgatg ttcacatctg atttggctac taacaatcta gttgtaatgg

     2041 cctacattac aggtggtgtt gttcagttga cttcgcagtg gctaactaac atctttggca

     2101 ctgtttatga aaaactcaaa cccgtccttg attggcttga agagaagttt aaggaaggtg

     2161 tagagtttct tagagacggt tgggaaattg ttaaatttat ctcaacctgt gcttgtgaaa

     2221 ttgtcggtgg acaaattgtc acctgtgcaa aggaaattaa ggagagtgtt cagacattct

     2281 ttaagcttgt aaataaattt ttggctttgt gtgctgactc tatcattatt ggtggagcta

     2341 aacttaaagc cttgaattta ggtgaaacat ttgtcacgca ctcaaaggga ttgtacagaa

     2401 agtgtgttaa atccagagaa gaaactggcc tactcatgcc tctaaaagcc ccaaaagaaa

     2461 ttatcttctt agagggagaa acacttccca cagaagtgtt aacagaggaa gttgtcttga

     2521 aaactggtga tttacaacca ttagaacaac ctactagtga agctgttgaa gctccattgg

     2581 ttggtacacc agtttgtatt aacgggctta tgttgctcga aatcaaagac acagaaaagt

     2641 actgtgccct tgcacctaat atgatg

Screen Shot 2020-04-27 at 7.35.49 PM.png

VIRT-48375:5’3′ Frame 2, start_pos=37

MKNSNPSLIGLKRSLRKV

DNA: Input sequence

FLIMVSPTAYHQNKDECWRG

X*

Reverse Translated sequence

TTYYTNATHATGGTNWSNCCNACNGCNTAYCAYCARAAYAARGAYGARTGYTGGMGNGGN

NNNTRR

tgatgaccc gtgtcctatt cacttctatt ctaaatggta tattagagta

    28021 ggagctagaa aatcagcacc tttaattgaa ttgtgcgtgg atgaggctgg ttctaaatca

    28081 cccattcagt acatcgatat cggtaattat acagtttcct gttcaccttt tacaattaat

    28141 tgccaggaac ctaaattggg tagtcttgta gtgcgttgtt cgttctatga agacttttta

    28201 gagtatcatg acgttcgtgt tgttttagat ttcatctaaa cgaacaaact aaaatgtctg

    28261 ataatggacc ccaaaatcag cgaaatgcac cccgcattac gtttggtgga ccctcagatt

    28321 caactggcag taaccagaat ggagaacgca gtggggcgcg atcaaaacaa cgtcggcccc

    28381 aaggtttacc caataatact gcgtcttggt tcaccgctct cactcaacat ggcaaggaag

    28441 accttaaatt ccctcgagga caaggcgttc caattaacac caatagcagt ccagatgacc

    28501 aaattggcta ctaccgaaga gctaccagac gaattcgtgg tggtgacggt aaaatgaaag

    28561 atctcagtcc aagatggtat ttctactacc taggaactgg gccagaagct ggacttccct

    28621 atggtgctaa caaagacggc atcatatggg ttgcaactga gggagccttg aatacaccaa

    28681 aagatcacat tggcacccgc aatcctgcta acaatgctgc aatcgtgcta caacttcctc

    28741 aaggaacaac attgccaaaa ggcttctacg cagaagggag cagaggcggc agtcaagcct

    28801 cttctcgttc ctcatcacgt agtcgcaaca gttcaagaaa ttcaactcca ggcagcagta

    28861 ggggaacttc tcctgctaga atggctggca atggcggtga tgctgctctt gctttgctgc

    28921 tgcttgacag attgaaccag cttgagagca aaatgtctgg taaaggccaa caacaacaag

    28981 gccaaactgt cactaagaaa tctgctgctg aggcttctaa gaagcctcgg caaaaacgta

    29041 ctgccactaa agcatacaat gtaacacaag ctttcggcag acgtggtcca gaacaaaccc

    29101 aaggaaattt tggggaccag gaactaatca gacaaggaac tgattacaaa cattggccgc

    29161 aaattgcaca atttgccccc agcgcttcag cgttcttcgg aatgtcgcgc attggcatgg

    29221 aagtcacacc ttcgggaacg tggttgacct acacaggtgc catcaaattg gatgacaaag

    29281 atccaaattt caaagatcaa gtcattttgc tgaataagca tattgacgca tacaaaacat

    29341 tcccaccaac agagcctaaa aaggacaaaa agaagaaggc tgatga

Screen Shot 2020-04-27 at 7.37.28 PM.png

> VIRT-31882:5’3′ Frame 3, start_pos=29

MRLVLNHPFSTSISVIIQFPVHLLQLIARNLNWVVL

DNA:

Input sequence

FLIMVSPTAYHQNKDECWRG

X*

Reverse Translated sequence

TTYYTNATHATGGTNWSNCCNACNGCNTAYCAYCARAAYAARGAYGARTGYTGGMGNGGN

NNNTRR

I have no real idea if I’ve done anything helpful but if you find use from it or can point me in the direction of further study I would appreciate it. Thanks.
J.

Sars-COv-2 ideas on how to stop it.

Sars-cov-2 : Learning the basic part of the system.

Spike glycoprotein (S PROTEIN SPLITTER)

Spikes go into section and splits it into two with a 4 protein residue left over in the cleavage plane.

Injects RBD (contains NLS): RNA Binding Domain, and Nuclear Localization Signal. 

RNA and N Protein

Envelope

Hemagglutinin-esterase dimer (HE). 

COVID-19 Proteins | Recombinant SARS-CoV-2

____

pre mRNA: called heterogeneous ribonucleoprotein particles (hnRNPs).

So what can we do if we target hnRNPs before they become mRNA and transfer into the splitting stage at the cycle of invasion or formation at the split. 

Building Autoantibodies for the Covid-19 issue:
So could we grab the hnRNPs of Covid-19 within it to study it? We  could also create an encasing shell that reaches for the spikes (S protein structure) with an extremely low ph percentile (within safe levels to blood without become up to a dangerous bronchi level) and upon that spike number once it is saturated, another is added if needed around it, swarms, and nullifies the cell, encasing it in a protease to destroy the inside as an artificial autoantibodies type.  

085C24B7-7F53-49A6-A025-12EBE500AB87.jpeg



So it takes two weeks to eradicate the outer cells of the lungs to get to the inner alveoli cell cluster and then the real damage is done. But how long does that take? Determined by the amount alveoli in the cluster. 

So there are multiple stages to work out for:

Bronchiole: reinforcement. Wider place to allow “healthful respiratory mucus medicine” to allocate. Hopeful sight. 

The outer cells of the alveoli (up to two weeks of treatment at least) but it has to be caught by the fever stage as thats the body saying that the body is fighting something. 

The alveoli stage: last resort, the cell is raw and unprotected. Those take a year to rebuild. Longer if your age cycle to cell rejuvenation cycle ratio is wider than optimal, (you’re older, or sickly with a longer term illness). That’s what you’re seeing in the damaging of the saved patients I think and should be checked for. 


Alveoli can be replaced with (silica is an option but there may be more forgiving materials) aerogel (2-5 nm minimally at the moment) sacks coated in pyrolytic carbon to be non rejectionary that are printed or formulated so that they allow the air in and convert to gasses within the strain limitations of the material within a natural breath at it’s users maximum. We don’t want them breaking down while being used, and if they do fill up and the user get’s water in the lung they can’t cough up, which the diaphragm should be able to do by reversing the pressure on it.  But if they can’t the user can be tested and those units can be replaced as a larger unit or allowed to live with the loss of use determined by those professionals working with their patients. I have a design for an artificial lung if you need it for free. 

____

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4234609/

Protease-based synthetic sensing and signal amplification:

Create artificial ON/OFF switches with protease synthetic… [come back to it, call came in] reread article. 

____

____

Previous thoughts: 

March 7th, 2020.

What we need to have to fight it. 

Identification of damaging units of RNA 
Protease reduction at site of entry. Something to absorb the hydrolysis., or at the very least move it away from the affected areas. 

The 5’ methylated CH3 chain can be blocked by using Flash Photolysis to destroy the hydrogen that cuts into the amino acid/peptide. Breaking the chain so that the methylated cap binds to itself leaving only C Remainder bond open for set up. 

Couldnt we intercept the Triple adenine base messenger RNA with Uracil or even Guanine if they can make it through and then flash them as well if its even needed as it could become inert at that point. At that point the Damaging RNA is connectionless. Just within the cell.

So what we could build is a chain of Uracil since they’re hydrogen, and excite them with an extra electron and add them to the end of the adenine seeing as you need 6 hydrogen. So it’s a matter of folding the carbon in on itself through propulsed flashing and then swinging it to bond to the other end of the virus making them inert.  

Attachment.png

So what happens if we insert these builds into the system through a breathing device after they’ve been flashed so that the farthest depth can be reached within the body making sure that the red blood cells carry the good stuff to the damaged area, so that they reach the cells that are affected, transfer into the systems of the cells, or at least bump into them, and cause the folding from interferons doing their duty once they realize that the virus is now inert and they can take it as waste to be disposed of while alerting other cells for the same infection. 

But how to do this within a syringe. Flashing seems simple enough to, rapidly done over the body. Painful and dangerous perhaps due to the weakened state of the patient. Perhaps an IV that keeps the body cool and creates a greater heat difference between the virus RNA and the cell its infecting so that they can be found and flashed without bringing the overall temperature of the human body into unsafe measures. 

Then it’s a matter of developing an interferon that can be made outside the body and with the inert virus folded so that it knows to attack it, which is should naturally know because its an unknown. Though it may present fever which may worsen people respiratory infections. 

EAA1047F-0F8C-48D2-A50C-7B9F3E14B157.jpeg

Folding Covid-19, Corona Virus using flash Photolysis onto itself to become inert at the Guanine + Uracil joins with hydrolysis.

Corona Virus’s

What we need to have to fight it. Just an idea.

Identification of damaging units of RNA 
Protease reduction at site of entry. Something to absorb the hydrolysis., or at the very least move it away from the affected areas. 

The 5’ methylated CH3 chain can be blocked by using Flash Photolysis to destroy the hydrogen that cuts into the amino acid/peptide. Breaking the chain so that the methylated cap binds to itself leaving only C Remainder bond open for set up. 

Couldnt we intercept the Triple adenine base messenger RNA with Uracil or even Guanine if they can make it through and then flash them as well if its even needed as it could become inert at that point. At that point the Damaging RNA is connectionless. Just within the cell.

So what we could build is a chain of Uracil since they’re hydrogen, and excite them with an extra electron and add them to the end of the adenine seeing as you need 6 hydrogen. So it’s a matter of folding the carbon in on itself through propulsed flashing and then swinging it to bond to the other end of the virus making them inert.  

Attachment.png

Flash CH3 at H then fold carbons: Guanine to opposing Uracil so that the virus becomes inert in a self folded way. Would be shaped inwardly.

So what happens if we insert these builds into the system through a breathing device after they’ve been flashed so that the farthest depth can be reached within the body making sure that the red blood cells carry the good stuff to the damaged area, so that they reach the cells that are affected, transfer into the systems of the cells, or at least bump into them, and cause the folding from interferons doing their duty once they realize that the virus is now inert and they can take it as waste to be disposed of while alerting other cells for the same infection. 

But how to do this within a syringe. Flashing seems simple enough to, rapidly done over the body. Painful and dangerous perhaps due to the weakened state of the patient. Perhaps an IV that keeps the body cool and creates a greater heat difference between the virus RNA and the cell its infecting so that they can be found and flashed without bringing the overall temperature of the human body into unsafe measures. 

Then it’s a matter of developing an interferon that can be made outside the body and with the inert virus folded so that it knows to attack it, which is should naturally know because its an unknown. Though it may present fever which may worsen people respiratory infections. 

3B2979CA-C4E8-43A1-89AD-F5E51367D45D.jpeg

Been messing with 4th Dimensional Chemistry. It’s fun. Oh, and magnetic monopoles—with pictures!

So I mess about with simulated capacitors, whatever else I can think of, and their energy potentials and build things that may not be able to be made today, but if they were would be of use to people in the future or now if I could get a more powerful rig to show the possibilities of their derivatives. That includes magnetic monopoles. Yes. No, not in spin ice. Similar—but different enough that I could patent the suckers tomorrow and they’d be under my name. But we know that’s not my style.

So let’s play the game.

Let’s start with a little 4th Dimensional Chemistry. All you need (Currently: First Iteration [Did I mention first try].) is a Bismuth Core, Ruthenium Outer Sheath to connect the Geometry to the outer sides of what I would have to call icicles but in reality is Arsenic crystals if you want extra hydrogen joins or just optional join points. The other is a carbon crystal of the same build that offered a single Delta Epsilon of roughly 9.8 (I don’t know what that means. I’ve looked it up 4 times and it’s just not sticking. if I could ask someone I would.) for and output of 98919 kJ/mol or roughly 27 KwH. If you run electricity through them they expand violently and up the power of a single mole to roughly 150,000 kJ/mol and then return to their shape once the power is through. So perhaps useful in space where they can expand as a net to gather debris if carbide is used to bind them properly. Though the output requires a vastly larger Delta Epsilon. Hydrogen is a better carrier. They are interconnectable into a three tiered lattice. I doubt they would last too long due to the half life of arsenic being 10 Days and Ruthenium only 2 Years, but the cores can be reused if not garbage Bismuth as they have an unheavenly long half life that’s worth looking up. Go on. It’s so long and I’m so lazy. Here’s a picture of the design with no numbers because then I’d have to start up my Wacom and open the app and re run it and then snap the screen and I’m like—nah, you try it. It’s more fun that way.

Credit: -J Townsend. 4th Dimensional Chemistry 02/14/2020. 1:45 a.m. Totally Doable. But is it worth while for this particular build. I don’t think so.

So you say how do I build this? That’s easy enough, theoretically since I don’t have the tools at hand.
A Bi core can be made through 3D printing or layering of gels that hold the atoms in place, if you want to get insanely technical we can do it on the space station using lasers to slow the fall of the atoms into the right places at once so they bond as needed. Doing the same for the Ruthenium and then you have a solid inert core that can have the other crystal “icicles” bonded properly as needed. Then they can be repeated as needed until you have your weave/lattice/or 3D construction. But realize if you you reverse the directions of these builds and jolt them alternating the level of power you’ll get a self walking chemical nanobot. You just divide sections by inserted inert atoms and you have lines of travel that can be independently controlled. Fun times. I’ll have to get to the monopoles—With picutres! Tomorrow. Err later today. It’s almost 2 a.m. and I need to get some sleep. Have a good Night/Day. Yours, -J.