Noticed SARS-COvid-02 has 19 dual Codon start paired triplets as well as 19 dual End Codon Paired triplets in it’s genome.

I’ve only been at this a few hours last night so forgive me if this is known information or unhelpful.

Scroll to the bottom of the page for the .pdf download of this. I need a geneticist to look it over to see if I’m going in any sort of right direction.

https://www.ncbi.nlm.nih.gov/nuccore/MT385497.1?expand-gaps=on
Work done by Jordan Townsend, 04/27/20

adenine, guanine, and cytosine, UraciL

CTACTA

ATAATA


adenine, guanine, and cytosine, thymine 

AUGAUG(19)UAAUAA(19)
GCAGCACGGCGG



AUGAUG and UAAUAA each have 19 iterations with 4 ends of UAGUAG and 25 UGAGUAG.

DNA bases that reflect these below at their ends:

GCAGCA = AlanineAlanine
CGGCGG = ArginineArginine

So could they be
atgatg ttcacatctg atttggctac taacaatcta gttgtaatgg

     2041 cctacattac aggtggtgtt gttcagttga cttcgcagtg gctaactaac atctttggca

     2101 ctgtttatga aaaactcaaa cccgtccttg attggcttga agagaagttt aaggaaggtg

     2161 tagagtttct tagagacggt tgggaaattg ttaaatttat ctcaacctgt gcttgtgaaa

     2221 ttgtcggtgg acaaattgtc acctgtgcaa aggaaattaa ggagagtgtt cagacattct

     2281 ttaagcttgt aaataaattt ttggctttgt gtgctgactc tatcattatt ggtggagcta

     2341 aacttaaagc cttgaattta ggtgaaacat ttgtcacgca ctcaaaggga ttgtacagaa

     2401 agtgtgttaa atccagagaa gaaactggcc tactcatgcc tctaaaagcc ccaaaagaaa

     2461 ttatcttctt agagggagaa acacttccca cagaagtgtt aacagaggaa gttgtcttga

     2521 aaactggtga tttacaacca ttagaacaac ctactagtga agctgttgaa gctccattgg

     2581 ttggtacacc agtttgtatt aacgggctta tgttgctcga aatcaaagac acagaaaagt

     2641 actgtgccct tgcacctaat atgatg

Screen Shot 2020-04-27 at 7.35.49 PM.png

VIRT-48375:5’3′ Frame 2, start_pos=37

MKNSNPSLIGLKRSLRKV

DNA: Input sequence

FLIMVSPTAYHQNKDECWRG

X*

Reverse Translated sequence

TTYYTNATHATGGTNWSNCCNACNGCNTAYCAYCARAAYAARGAYGARTGYTGGMGNGGN

NNNTRR

tgatgaccc gtgtcctatt cacttctatt ctaaatggta tattagagta

    28021 ggagctagaa aatcagcacc tttaattgaa ttgtgcgtgg atgaggctgg ttctaaatca

    28081 cccattcagt acatcgatat cggtaattat acagtttcct gttcaccttt tacaattaat

    28141 tgccaggaac ctaaattggg tagtcttgta gtgcgttgtt cgttctatga agacttttta

    28201 gagtatcatg acgttcgtgt tgttttagat ttcatctaaa cgaacaaact aaaatgtctg

    28261 ataatggacc ccaaaatcag cgaaatgcac cccgcattac gtttggtgga ccctcagatt

    28321 caactggcag taaccagaat ggagaacgca gtggggcgcg atcaaaacaa cgtcggcccc

    28381 aaggtttacc caataatact gcgtcttggt tcaccgctct cactcaacat ggcaaggaag

    28441 accttaaatt ccctcgagga caaggcgttc caattaacac caatagcagt ccagatgacc

    28501 aaattggcta ctaccgaaga gctaccagac gaattcgtgg tggtgacggt aaaatgaaag

    28561 atctcagtcc aagatggtat ttctactacc taggaactgg gccagaagct ggacttccct

    28621 atggtgctaa caaagacggc atcatatggg ttgcaactga gggagccttg aatacaccaa

    28681 aagatcacat tggcacccgc aatcctgcta acaatgctgc aatcgtgcta caacttcctc

    28741 aaggaacaac attgccaaaa ggcttctacg cagaagggag cagaggcggc agtcaagcct

    28801 cttctcgttc ctcatcacgt agtcgcaaca gttcaagaaa ttcaactcca ggcagcagta

    28861 ggggaacttc tcctgctaga atggctggca atggcggtga tgctgctctt gctttgctgc

    28921 tgcttgacag attgaaccag cttgagagca aaatgtctgg taaaggccaa caacaacaag

    28981 gccaaactgt cactaagaaa tctgctgctg aggcttctaa gaagcctcgg caaaaacgta

    29041 ctgccactaa agcatacaat gtaacacaag ctttcggcag acgtggtcca gaacaaaccc

    29101 aaggaaattt tggggaccag gaactaatca gacaaggaac tgattacaaa cattggccgc

    29161 aaattgcaca atttgccccc agcgcttcag cgttcttcgg aatgtcgcgc attggcatgg

    29221 aagtcacacc ttcgggaacg tggttgacct acacaggtgc catcaaattg gatgacaaag

    29281 atccaaattt caaagatcaa gtcattttgc tgaataagca tattgacgca tacaaaacat

    29341 tcccaccaac agagcctaaa aaggacaaaa agaagaaggc tgatga

Screen Shot 2020-04-27 at 7.37.28 PM.png

> VIRT-31882:5’3′ Frame 3, start_pos=29

MRLVLNHPFSTSISVIIQFPVHLLQLIARNLNWVVL

DNA:

Input sequence

FLIMVSPTAYHQNKDECWRG

X*

Reverse Translated sequence

TTYYTNATHATGGTNWSNCCNACNGCNTAYCAYCARAAYAARGAYGARTGYTGGMGNGGN

NNNTRR

I have no real idea if I’ve done anything helpful but if you find use from it or can point me in the direction of further study I would appreciate it. Thanks.
J.

Leave a Reply

Fill in your details below or click an icon to log in:

WordPress.com Logo

You are commenting using your WordPress.com account. Log Out /  Change )

Google photo

You are commenting using your Google account. Log Out /  Change )

Twitter picture

You are commenting using your Twitter account. Log Out /  Change )

Facebook photo

You are commenting using your Facebook account. Log Out /  Change )

Connecting to %s